(uploaded on: . ) draft food safety and standards (contaminants, toxins and residues) amendment regulation, related to tolerance limit of antibiotics and pharmacology active substances....
; at the same time, fiber's absorption of a great deal of water in intestines helps soften stool, and ease defecation. to sum up, pine pollen can alleviate all kinds of constipation effectively and safely, but it should be taken with large amount of water so as to facilitate the excretion of wastes from...
; at the same time, fiber's absorption of a great deal of water in intestines helps soften stool, and ease defecation. to sum up, pine pollen can alleviate all kinds of constipation effectively and safely, but it should be taken with large amount of water so as to facilitate the excretion of wastes from...
peptide which is rapidly cleaved after translation of the amino acid coding sequence. the human sequence (from n-terminus to c-terminus ) is: (mgilklqvflivlsvalnhlka) tpieshqvekr^ kcntatcatqrlanflvhssnnfgailsstnvgsntyg^ kr^ navevlkreplnylpl. [ ] [ ] the signal peptide is removed during translation of...
eggs spores of cryptosporidium (a protozoan) resistant to drinking water treatment processes spores of giardia human pathogenic bacteria such as brucella and salmonella animal wastes from cattle can be produced as solid or semisolid manure or as a liquid slurry . the production of slurry is especially...
, netzsch began developing and manufacturing its successful range of tornado rotary lobe pumps. tornado pumps are used in a constantly growing number of applications for continuous and gentle conveyance ofsubstances. t , the second generation of tornado, was introduced by netzsch in . its new design...
burden. if you've always considered fatty liver disease to be an alcoholic's burden, you may want to think again. there are actually types offatty liver disease – alcohol-induced and non-alcoholic fatty liver disease (nafld). around % of asian adults suffer from one of the forms, and a recent study...
in a high level of safety in the production, application and disposal of our products. we generally see innovative potential for products based on nanotechnology. we encourage dialogue on nanotechnology between our experts and industrial associations, the authorities, scientists and other stakeholders...
of finance skip to main content search the web dor.gov.in search a+ a a- a a language हिन्दी राजस्व विभाग department of revenue menu home about us about the department functions who's who revenue secretary rs since independence fm since independence meet the minister/s finance minister minister of state...